O54957

FUNCTION: Required for TCR (T-cell antigen receptor)- and pre-TCR- mediated signaling, both in mature T-cells and during their development. Involved in FCGR3 (low affinity immunoglobulin gamma Fc region receptor III)-mediated signaling in natural killer cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Couples activation of these receptors and their associated kinases with distal intracellular events such as mobilization of intracellular calcium stores, PKC activation, MAPK activation or cytoskeletal reorganization through the recruitment of PLCG1, GRB2, GRAP2, and other signaling molecules. SUBUNIT: When phosphorylated, interacts directly with the PIK3R1 subunit of phosphoinositide 3-kinase and the SH2 domains of GRB2, GRAP, GRAP2, PLCG1 and PLCG2. Interacts indirectly with CBL, SOS, VAV, and LCP2. Interacts with SHB and SKAP2. Interacts with FCGR1A (By similarity). Interacts with CLNK. SUBCELLULAR LOCATION: Cell membrane; Single-pass type III membrane protein. Note=Present in lipid rafts. TISSUE SPECIFICITY: Expressed in T-cells and mast cells. PTM: Phosphorylated on tyrosines by ZAP70 upon TCR activation, or by SYK upon other immunoreceptor activation; which leads to the recruitment of multiple signaling molecules. Is one of the most prominently tyrosine-phosphorylated proteins detected following TCR engagement. May be dephosphorylated by PTPRJ. Phosphorylated by ITK leading to the recruitment of VAV1 to LAT-containing complexes (By similarity). PTM: Palmitoylation of Cys-27 and Cys-30 is required for raft targeting and efficient phosphorylation (By similarity). MISCELLANEOUS: Engagement of killer inhibitory receptors (KIR) disrupts the interaction of PLCG1 with LAT and blocks target cell- induced activation of PLC, maybe by inducing the dephosphorylation of LAT (By similarity). GENE SYNONYMS:Lat. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License., SEQUENCE 242 AA; 26015 MW; 6AC25F7AE6E1A5C1 CRC64;

LAT_MOUSE

urn:biopax:ModificationFeature:LAT_MOUSE_1, urn:biopax:ModificationFeature:LAT_MOUSE_10, urn:biopax:ModificationFeature:LAT_MOUSE_11, urn:biopax:ModificationFeature:LAT_MOUSE_12, urn:biopax:ModificationFeature:LAT_MOUSE_13, urn:biopax:ModificationFeature:LAT_MOUSE_14, urn:biopax:ModificationFeature:LAT_MOUSE_15, urn:biopax:ModificationFeature:LAT_MOUSE_16, urn:biopax:ModificationFeature:LAT_MOUSE_2, urn:biopax:ModificationFeature:LAT_MOUSE_3, urn:biopax:ModificationFeature:LAT_MOUSE_4, urn:biopax:ModificationFeature:LAT_MOUSE_5, urn:biopax:ModificationFeature:LAT_MOUSE_6, urn:biopax:ModificationFeature:LAT_MOUSE_7, urn:biopax:ModificationFeature:LAT_MOUSE_8, urn:biopax:ModificationFeature:LAT_MOUSE_9

MEADALSPVGLGLLLLPFLVTLLAALCVRCRELPVSYDSTSTESLYPRSILIKPPQITVPRTPAVSYPLVTSFPPLRQPDLLPIPRSPQPLGGSHRMPSSQQNSDDANSVASYENQEPACKNVDADEDEDDYPNGYLVVLPDSSPAAVPVVSSAPVPSNPDLGDSAFSVESCEDYVNVPESEESAEASLDGSREYVNVSPEQQPVTRAELASVNSQEVEDEGEEEGVDGEEAPDYENLQELN