| http://identifiers.org/unip... | rdf:type | biopax3:ProteinReference | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | SEQUENCE 276 AA; 31129 MW; 5C7B32A1127B0F59 CRC64; | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | FUNCTION: Preferentially catalyzes the dephosphorylation of 'Ser- 5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation (By similarity). Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells. CATALYTIC ACTIVITY: A phosphoprotein + H(2)O = a protein + phosphate. COFACTOR: Binds 1 magnesium ion per monomer (By similarity). SUBUNIT: Monomer. Interacts with REST. SUBCELLULAR LOCATION: Nucleus (By similarity). ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=HYA22B; IsoId=O15194-1; Sequence=Displayed; Name=2; Synonyms=HYA22A; IsoId=O15194-2; Sequence=VSP_011541; TISSUE SPECIFICITY: Expression is restricted to non-neuronal tissues. SIMILARITY: Contains 1 FCP1 homology domain. SEQUENCE CAUTION: Sequence=BAA21667.1; Type=Erroneous initiation; GENE SYNONYMS:CTDSPL C3orf8 NIF1 NIFL SCP3 YA22. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License. | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:displayName | CTDSL_HUMAN | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | SCP3 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | 3.1.3.16 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | NIF-like protein | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | NLI-interacting factor 1 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Small CTD phosphatase 3 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Nuclear LIM interactor-interacting factor 1 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | RBSP3 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | CTDSPL | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Small C-terminal domain phosphatase 3 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Protein YA22 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | hYA22 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | CTDSP-like | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:entityFeature | urn:biopax:ModificationFeat... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:organism | http://identifiers.org/taxo... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:sequence | MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKGDQRQVIPIPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSREDDVYSMLHRLCNR | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:standardName | CTD small phosphatase-like protein | lld:biopax3 |
| http://pid.nci.nih.gov/biop... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| HTTP://PATHWAYCOMMONS.ORG/P... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://pid.nci.nih.gov/biop... | biopax3:memberEntityReferen... | http://identifiers.org/unip... | lld:biopax3 |
