Predicate | Object |
---|---|
rdf:type | |
biopax3:comment |
FUNCTION: Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses. SUBCELLULAR LOCATION: Secreted. TISSUE SPECIFICITY: High levels in peripheral blood leukocytes, pancreas and liver astrocytes. Moderate levels in thymus, spleen and lung. Low levels in placenta, prostate and small intestine. Also found in epidermal basal layer keratinocytes in skin disorders. INDUCTION: By IFNG/IFN-gamma and IFNB1/IFN-beta. Induction by IFNG/IFN-gamma is enhanced by TNF in monocytes, dermal fibroblasts and endothelial cells, and by IL1/interleukin-1 in astrocytes. MASS SPECTROMETRY: Mass=8303; Method=MALDI; Range=22-94; Source=PubMed:10233762; SIMILARITY: Belongs to the intercrine alpha (chemokine CxC) family. SEQUENCE CAUTION: Sequence=AAB17374.1; Type=Erroneous initiation; WEB RESOURCE: Name=Wikipedia; Note=CXCL11 entry; URL="http://en.wikipedia.org/wiki/CXCL11"; GENE SYNONYMS:CXCL11 ITAC SCYB11 SCYB9B. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 94 AA; 10365 MW; 9D9D8585749EA4CE CRC64;
|
biopax3:xref | |
biopax3:displayName |
CXL11_HUMAN
|
biopax3:name |
Beta-R1,
CXCL11,
H174,
I-TAC,
IP-9,
Interferon gamma-inducible protein 9,
Interferon-inducible T-cell alpha chemoattractant,
Small-inducible cytokine B11
|
biopax3:entityFeature | |
biopax3:organism | |
biopax3:sequence |
MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
|
biopax3:standardName |
C-X-C motif chemokine 11
|