| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: May be involved in targeting uroplakins to urothelial apical membranes (By similarity). SUBUNIT: Binds SYTL4 and MYRIP. Interacts with SYTL2 (By similarity). SUBCELLULAR LOCATION: Membrane; Lipid-anchor. TISSUE SPECIFICITY: Expressed primarily in testis. SIMILARITY: Belongs to the small GTPase superfamily. Rab family. GENE SYNONYMS:RAB27B. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 218 AA; 24608 MW; 8ED640F0C15EDCD3 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
RB27B_HUMAN
|
| biopax3:name |
C25KG,
RAB27B
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
|
| biopax3:standardName |
Ras-related protein Rab-27B
|