| http://identifiers.org/unip... | rdf:type | biopax3:ProteinReference | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | SEQUENCE 192 AA; 21995 MW; D7E720D0DDCCA249 CRC64; | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | CATALYTIC ACTIVITY: ATP + (R)-5-phosphomevalonate = ADP + (R)-5- diphosphomevalonate. BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=25 uM for (R)-5-phosphomevalonate; KM=0.26 mM for ATP; Vmax=46.4 umol/min/mg enzyme with (R)-5-phosphomevalonate as substrate; Vmax=52 umol/min/mg enzyme with ATP as substrate; PATHWAY: Isoprenoid biosynthesis; isopentenyl diphosphate biosynthesis via mevalonate pathway; isopentenyl diphosphate from (R)-mevalonate: step 2/3. SUBUNIT: Monomer (By similarity). SUBCELLULAR LOCATION: Peroxisome. TISSUE SPECIFICITY: Heart, liver, skeletal muscle, kidney, and pancreas. Lower level in brain, placenta and lung. INDUCTION: By sterol. GENE SYNONYMS:PMVK PMKI. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License. | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:displayName | PMVK_HUMAN | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | 2.7.4.2 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | PMKase | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | hPMK | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | PMVK | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:organism | http://identifiers.org/taxo... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:sequence | MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:standardName | Phosphomevalonate kinase | lld:biopax3 |
| http://biocyc.org/biopax/bi... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://www.reactome.org/bio... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://pid.nci.nih.gov/biop... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://www.pantherdb.org/pa... | biopax3:memberEntityReferen... | http://identifiers.org/unip... | lld:biopax3 |
