| http://identifiers.org/unip... | rdf:type | biopax3:ProteinReference | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | FUNCTION: May play an important role in B-cell differentiation as well as neural development and spermatogenesis. Involved in the regulation of the CD19 gene, a B-lymphoid-specific target gene. SUBUNIT: Interacts with DAXX (By similarity). Binds DNA as a monomer. Binds TLE4. SUBCELLULAR LOCATION: Nucleus. DEVELOPMENTAL STAGE: Expressed at early B-cell differentiation, in the developing CNS and in adult testis. PTM: O-glycosylated (Probable). DISEASE: Note=A chromosomal aberration involving PAX5 is a cause of acute lymphoblastic leukemia. Translocation t(9;18)(p13;q11.2) with ZNF521. Translocation t(9;3)(p13;p14.1) with FOXP1. Translocation t(9;12)(p13;p13) with ETV6. SIMILARITY: Contains 1 paired domain. WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL="http://atlasgeneticsoncology.org/Genes/PAX5ID62.html"; GENE SYNONYMS:PAX5. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License. | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | SEQUENCE 391 AA; 42149 MW; DB37E6EACD9F993A CRC64; | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:displayName | PAX5_HUMAN | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | PAX5 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | BSAP | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | B-cell-specific transcription factor | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:organism | http://identifiers.org/taxo... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:sequence | MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:standardName | Paired box protein Pax-5 | lld:biopax3 |
| http://pid.nci.nih.gov/biop... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| HTTP://PATHWAYCOMMONS.ORG/P... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://pid.nci.nih.gov/biop... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
