| http://identifiers.org/unip... | rdf:type | biopax3:ProteinReference | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | SEQUENCE 119 AA; 12999 MW; 7FC38B56B4DCEFBC CRC64; | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | FUNCTION: ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. ID-3 inhibits the binding of E2A-containing protein complexes to muscle creatine kinase E-box enhancer. May inhibit other transcription factors. SUBUNIT: Interacts with COPS5 and COPS7A (By similarity). Homodimer, and heterodimer with other HLH proteins. SUBCELLULAR LOCATION: Nucleus. TISSUE SPECIFICITY: Expressed abundantly in lung, kidney and adrenal gland, but not in adult brain. INDUCTION: By phorbol 12-myristate 13-acetate (PMA). SIMILARITY: Contains 1 basic helix-loop-helix (bHLH) domain. SEQUENCE CAUTION: Sequence=CAA47360.1; Type=Erroneous initiation; Note=Translation N-terminally shortened; GENE SYNONYMS:ID3 1R21 BHLHB25 HEIR1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License. | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:displayName | ID3_HUMAN | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Inhibitor of DNA binding 3 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | ID3 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | ID-like protein inhibitor HLH 1R21 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Class B basic helix-loop-helix protein 25 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | bHLHb25 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Helix-loop-helix protein HEIR-1 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:organism | http://identifiers.org/taxo... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:sequence | MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:standardName | DNA-binding protein inhibitor ID-3 | lld:biopax3 |
| HTTP://PATHWAYCOMMONS.ORG/P... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://www.phosphosite.org/... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://www.phosphosite.org/... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
