| http://identifiers.org/unip... | rdf:type | biopax3:ProteinReference | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | FUNCTION: Involved in mating signal transduction pathway. CATALYTIC ACTIVITY: ATP + a protein = ADP + a phosphoprotein. COFACTOR: Magnesium (By similarity). ENZYME REGULATION: Activated by tyrosine and threonine phosphorylation. SUBCELLULAR LOCATION: Nucleus. Note=Mainly nuclear. DOMAIN: The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases. PTM: Dually phosphorylated on Thr-199 and Tyr-201, which activates the enzyme (By similarity). SIMILARITY: Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily. SIMILARITY: Contains 1 protein kinase domain. CAUTION: Was originally (PubMed:1899230) thought to confer resistance to staurosporine. GENE SYNONYMS:spk1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License. | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | SEQUENCE 372 AA; 42003 MW; 85D980514C9386C7 CRC64; | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:displayName | SPK1_SCHPO | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | MAPK | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | 2.7.11.24 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | MAP kinase spk1 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | spk1 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:entityFeature | urn:biopax:ModificationFeat... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:entityFeature | urn:biopax:ModificationFeat... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:organism | http://identifiers.org/taxo... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:sequence | MASATSTPTIADGNSNKESVATSRSPHTHDLNFELPEEYEMINLIGQGAYGVVCAALHKPSGLKVAVKKIHPFNHPVFCLRTLREIKLLRHFRHENIISILDILPPPSYQELEDVYIVQELMETDLYRVIRSQPLSDDHCQYFTYQILRALKAMHSAGVVHRDLKPSNLLLNANCDLKVADFGLARSTTAQGGNPGFMTEYVATRWYRAPEIMLSFREYSKAIDLWSTGCILAEMLSARPLFPGKDYHSQITLILNILGTPTMDDFSRIKSARARKYIKSLPFTPKVSFKALFPQASPDAIDLLEKLLTFNPDKRITAEEALKHPYVAAYHDASDEPTASPMPPNLVDLYCNKEDLEIPVLKALIFREVNFR | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:standardName | Mitogen-activated protein kinase spk1 | lld:biopax3 |
| http://www.pantherdb.org/pa... | biopax3:memberEntityReferen... | http://identifiers.org/unip... | lld:biopax3 |
| http://www.pantherdb.org/pa... | biopax3:memberEntityReferen... | http://identifiers.org/unip... | lld:biopax3 |
| http://www.pantherdb.org/pa... | biopax3:memberEntityReferen... | http://identifiers.org/unip... | lld:biopax3 |
| http://www.pantherdb.org/pa... | biopax3:memberEntityReferen... | http://identifiers.org/unip... | lld:biopax3 |
| http://www.pantherdb.org/pa... | biopax3:memberEntityReferen... | http://identifiers.org/unip... | lld:biopax3 |
