| http://identifiers.org/unip... | rdf:type | biopax3:ProteinReference | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | SEQUENCE 365 AA; 39721 MW; 928DE396C58E295B CRC64; | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | FUNCTION: Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. SUBUNIT: Interacts with PORCN (By similarity). SUBCELLULAR LOCATION: Secreted, extracellular space, extracellular matrix. SIMILARITY: Belongs to the Wnt family. GENE SYNONYMS:WNT6. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License. | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:displayName | WNT6_HUMAN | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | WNT6 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:organism | http://identifiers.org/taxo... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:sequence | MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:standardName | Protein Wnt-6 | lld:biopax3 |
| HTTP://PATHWAYCOMMONS.ORG/P... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://www.reactome.org/bio... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://www.pantherdb.org/pa... | biopax3:memberEntityReferen... | http://identifiers.org/unip... | lld:biopax3 |
