| http://identifiers.org/unip... | rdf:type | biopax3:ProteinReference | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | FUNCTION: Involved in stress resistance and actin organization. SUBUNIT: Associates with alpha- and beta-tubulin, microtubules and CRYAB. Interacts with HSPB8 (By similarity). Interacts with HSPBAP1 and TGFB1I1. SUBCELLULAR LOCATION: Cytoplasm (By similarity). Nucleus (By similarity). Cytoplasm, cytoskeleton, spindle (By similarity). Note=Cytoplasmic in interphase cells. Colocalizes with mitotic spindles in mitotic cells. Translocates to the nucleus during heat shock and resides in sub-nuclear structures known as SC35 speckles or nuclear splicing speckles (By similarity). TISSUE SPECIFICITY: Expressed in a variety of tissues. High levels in lung, adrenal, xiphoid, adipose tissue, heart and striated and smooth muscle, lower levels in the CNS. Adult levels are much higher in the slow-twitch soleus muscle than in the fast-twitch rectus femoris and extensor digitorum muscles. DEVELOPMENTAL STAGE: Expressed in the soleus and rectus femoris muscles at prenatal day 2, increasing to a maximum at postnatal day 3. Expression in the rectus femoris muscle then decreases reaching adult levels within a few weeks. PTM: Phosphorylation by MAPKAPK2 and MAPKAPK3 in response to stress leads to dissociate HSP27/HSPB1 from large small heat-shock protein (sHsps) oligomers and impair its chaperone activity and ability to protect against oxidative stress effectively. Phosphorylation by MAPKAPK5 in response to PKA stimulation induces F-actin rearrangement (By similarity). SIMILARITY: Belongs to the small heat shock protein (HSP20) family. GENE SYNONYMS:Hspb1 Hsp27. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License. | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | SEQUENCE 206 AA; 22893 MW; 1CEC75582E5E34B2 CRC64; | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:displayName | HSPB1_RAT | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Hspb1 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | HspB1 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Heat shock 27 kDa protein | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | HSP 27 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:entityFeature | urn:biopax:ModificationFeat... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:entityFeature | urn:biopax:ModificationFeat... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:entityFeature | urn:biopax:ModificationFeat... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:entityFeature | urn:biopax:ModificationFeat... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:entityFeature | urn:biopax:ModificationFeat... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:entityFeature | urn:biopax:ModificationFeat... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:entityFeature | urn:biopax:ModificationFeat... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:organism | http://identifiers.org/taxo... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:sequence | MTERRVPFSLLRSPSWEPFRDWYPAHSRLFDQAFGVPRFPDEWSQWFSSAGWPGYVRPLPAATAEGPAAVTLARPAFSRALNRQLSSGVSEIRQTADRWRVSLDVNHFAPEELTVKTKEGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKAVTQSAEITIPVTFEARAQIGGPESEQSGAK | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:standardName | Heat shock protein beta-1 | lld:biopax3 |
| http://www.phosphosite.org/... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://www.phosphosite.org/... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://www.phosphosite.org/... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://www.phosphosite.org/... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://www.phosphosite.org/... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://www.pantherdb.org/pa... | biopax3:memberEntityReferen... | http://identifiers.org/unip... | lld:biopax3 |
