| http://identifiers.org/unip... | rdf:type | biopax3:ProteinReference | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | FUNCTION: This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol- calcium second messenger system. SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. SIMILARITY: Belongs to the G-protein coupled receptor 1 family. Adrenergic receptor subfamily. ADRA1B sub-subfamily. GENE SYNONYMS:ADRA1B. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License. | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | SEQUENCE 515 AA; 56493 MW; 6DAF1576D1C1CE2D CRC64; | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:displayName | ADA1B_MESAU | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Alpha-1B adrenoceptor | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | ADRA1B | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Alpha-1B adrenoreceptor | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:entityFeature | urn:biopax:ModificationFeat... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:entityFeature | urn:biopax:ModificationFeat... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:organism | http://identifiers.org/taxo... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:sequence | MNPDLDTGHNTSAPAQWGELKDANFTGPNQTSSNSTLPQLDVTRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRILGCQCRSGRRRRRRRRLGACAYTYRPWTRGGSLERSQSRKDSLDDSGSCMSGSQRTLPSASPSPGYLGRGAQPPLELCAYPEWKSGALLSLPEPPGRRGRLDSGPLFTFKLLGEPESPGTEGDASNGGCDATTDLANGQPGFKSNMPLAPGHF | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:standardName | Alpha-1B adrenergic receptor | lld:biopax3 |
| http://www.phosphosite.org/... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://www.phosphosite.org/... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://www.phosphosite.org/... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://www.phosphosite.org/... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://www.phosphosite.org/... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://www.phosphosite.org/... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
