| http://identifiers.org/unip... | rdf:type | biopax3:ProteinReference | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | SEQUENCE 125 AA; 12722 MW; C65BB544731A0E7C CRC64; | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | FUNCTION: Neurophysin 1 specifically binds oxytocin. FUNCTION: Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. SUBCELLULAR LOCATION: Secreted. PHARMACEUTICAL: Oxytocin is available under the names Pitocin (Parke-Davis) and Syntocinon (Sandoz). Used to artificially speed or induce labor. SIMILARITY: Belongs to the vasopressin/oxytocin family. WEB RESOURCE: Name=Wikipedia; Note=Oxytocin entry; URL="http://en.wikipedia.org/wiki/Oxytocin"; GENE SYNONYMS:OXT OT. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License. | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:displayName | NEU1_HUMAN | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Neurophysin 1 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | OT-NPI | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Ocytocin | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Oxytocin | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | OXT | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:entityFeature | urn:biopax:ModificationFeat... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:organism | http://identifiers.org/taxo... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:sequence | MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:standardName | Oxytocin-neurophysin 1 | lld:biopax3 |
| http://pid.nci.nih.gov/biop... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://www.reactome.org/bio... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| HTTP://PATHWAYCOMMONS.ORG/P... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://pid.nci.nih.gov/biop... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://www.pantherdb.org/pa... | biopax3:memberEntityReferen... | http://identifiers.org/unip... | lld:biopax3 |
| http://www.pantherdb.org/pa... | biopax3:memberEntityReferen... | http://identifiers.org/unip... | lld:biopax3 |
| http://www.pantherdb.org/pa... | biopax3:memberEntityReferen... | http://identifiers.org/unip... | lld:biopax3 |
| http://www.pantherdb.org/pa... | biopax3:memberEntityReferen... | http://identifiers.org/unip... | lld:biopax3 |
| http://www.pantherdb.org/pa... | biopax3:memberEntityReferen... | http://identifiers.org/unip... | lld:biopax3 |
| http://www.pantherdb.org/pa... | biopax3:memberEntityReferen... | http://identifiers.org/unip... | lld:biopax3 |
