| http://identifiers.org/unip... | rdf:type | biopax3:ProteinReference | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | FUNCTION: DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication. SUBUNIT: Heterodimer of a small subunit and a large subunit. SIMILARITY: Belongs to the eukaryotic-type primase large subunit family. GENE SYNONYMS:Prim2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License. | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | SEQUENCE 507 AA; 58603 MW; 14859CA259DF054A CRC64; | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:displayName | PRI2_RAT | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | 2.7.7.- | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | p58 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | DNA primase 58 kDa subunit | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Prim2 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:entityFeature | urn:biopax:ModificationFeat... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:organism | http://identifiers.org/taxo... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:sequence | MQFSGRTRKKLRLAGDQRNACYPHSLQFYLQPPTENISLTEFESLAFDRVKLLKAIENLGVSYVKGTEQYQSKLEAEIRKLKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEDLRRWFIQQEMDLLRFRFSILPKDKVQSFLKDTHLHFEAISDEEKTLREQDIMASSPSLSGVRWESESVYKVPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRATLSKALALTARSLPAVQSDERLQPLLSHLSHSYTGQDYSTQKSTGKISLDQIDSLSTKSFPPCMRQLHKALRENHHLRHGGRMQYGLFLKGIGLTLEQALQFWKQEFIKGKMDPDKFDKGYSYNIRHSFGKEGKRTDYTPFSCMKIILTNPPSQGDFHGCPFRHSDAELLKQKMQTYKIPASGISQILDLVKGNHYQVACQKYFEMTHNVDDCGFSLNHPNQFFFESQRILTGGKDIKKEASHPETPQHKPSTQKTKDATSALASLDSSLEMDLEGLEDYFSK | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:standardName | DNA primase large subunit | lld:biopax3 |
| http://www.pantherdb.org/pa... | biopax3:memberEntityReferen... | http://identifiers.org/unip... | lld:biopax3 |
