Organism: unknown
Gene name: lspA
Existence: Inferred from Homology Existence
Reviewed: true
Molecular weight: 18575 Da
Sequence: MVTKKSKKAWPWLWFSVLVILLDQLSKYLANHFLSLGHPVKILPFLNFTLNYNTGAAFSFLGTENGWQIIFFAAISFVVSIFLILWLSRTSRSEIMMLLGLSLIIGGALGNFIDRLRWSYVTDFIDFHIKDWHFATFNVADSAICVGVFLLIVHMLLTPSSKP
General annotations
Helical;
This protein specifically catalyzes the removal of signal peptides from prolipoproteins (By similarity).
Release of signal peptides from bacterial membrane prolipoproteins. Hydrolyzes -Xaa-Yaa-Zaa-|-(S,diacylglyceryl)Cys-, in which Xaa is hydrophobic (preferably Leu), and Yaa (Ala or Ser) and Zaa (Gly or Ala) have small, neutral side chains.
Protein modification; lipoprotein biosynthesis (signal peptide cleavage).
Belongs to the peptidase A8 family.