Organism: unknown
Gene name: Q1Q9H6
Existence: Inferred from Homology Existence
Reviewed: false
Molecular weight: 19309 Da
Sequence: MNKTMLASALLCGSALAMTGCQTVESQMQTGNPLNQPVLKSTINAVTGDKNEVGQMFLRPVDGGVQVYGKLMNLQPGQTVSLHIHETGSCGNMGKAAGGHFNPDNKPHSNPDDMNGHAGDLPNLTANADGVATINYVNKKISAADAGKYSVNRLAFIVHSGVDDYTSQPAGNAGDRVACGIIEKR
General annotations
Binds 1 zinc ion per subunit (By similarity).
Binds 1 copper ion per subunit (By similarity).
Destroys radicals which are normally produced within the cells and which are toxic to biological systems (By similarity).
2 superoxide + 2 H(+) = O(2) + H(2)O(2).
Belongs to the Cu-Zn superoxide dismutase family.