| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: The natural substrate for this enzyme may be peptidyl- tRNAs which drop off the ribosome during protein synthesis (By similarity). FUNCTION: Promotes caspase-independent apoptosis by regulating the function of two transcriptional regulators, AES and TLE1. CATALYTIC ACTIVITY: N-substituted aminoacyl-tRNA + H(2)O = N- substituted amino acid + tRNA. SUBUNIT: Monomer. SUBCELLULAR LOCATION: Mitochondrion. SIMILARITY: Belongs to the PTH2 family. GENE SYNONYMS:PTRH2 BIT1 PTH2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 179 AA; 19194 MW; 11A0BA9ECF6B5E46 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
PTH2_HUMAN
|
| biopax3:name |
3.1.1.29,
Bcl-2 inhibitor of transcription 1,
PTH 2,
PTRH2
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
|
| biopax3:standardName |
Peptidyl-tRNA hydrolase 2, mitochondrial
|