Statements in which the resource exists as a subject.
PredicateObject
rdf:type
biopax3:comment
FUNCTION: Transcriptionally activator that may play a role in regulating the later stages of keratinocytes terminal differentiation. FUNCTION: Isoform 2 binds to DNA sequences containing the consensus nucleotide core sequence GGA[AT]. Transcriptionally activates SPRR2A and the parotid gland-specific PSP promoters. SUBCELLULAR LOCATION: Nucleus (By similarity). ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=ESE-2a; IsoId=Q9UKW6-1; Sequence=Displayed; Name=2; Synonyms=ESE-2b; IsoId=Q9UKW6-2; Sequence=VSP_014510; Name=3; IsoId=Q9UKW6-3; Sequence=VSP_014510, VSP_014511, VSP_014512; Note=No experimental confirmation available; TISSUE SPECIFICITY: Expressed exclusively in tissues with a high content of epithelial cells. Highly expressed in salivary gland, mammary gland, kidney and prostate. Weakly expressed in placenta and lung. Isoform 1 and isoform 2 are differentially expressed in different tissues. In the kidney, only isoform 1 was expressed, while prostate expressed both isoforms, with levels of isoform 2 being higher. Expression is up-regulated during keratinocyte differentiation. Several epithelial carcinoma cell lines showed lack of expression. DOMAIN: The PNT domain acts as a transcriptional activator (By similarity). SIMILARITY: Belongs to the ETS family. SIMILARITY: Contains 1 ETS DNA-binding domain. SIMILARITY: Contains 1 PNT (pointed) domain. GENE SYNONYMS:ELF5 ESE2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License., SEQUENCE 265 AA; 31263 MW; 43821A79A45768FE CRC64;
biopax3:xref
biopax3:displayName
ELF5_HUMAN
biopax3:name
E74-like factor 5, ELF5, ESE-2, Epithelium-restricted ESE-1-related Ets factor, Epithelium-specific Ets transcription factor 2
biopax3:organism
biopax3:sequence
MPSLPHSHRVMLDSVTHSTFLPNASFCDPLMSWTDLFSNEEYYPAFEHQTACDSYWTSVHPEYWTKRHVWEWLQFCCDQYKLDTNCISFCNFNISGLQLCSMTQEEFVEAAGLCGEYLYFILQNIRTQGYSFFNDAEESKATIKDYADSNCLKTSGIKSQDCHSHSRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNAHGWQEDKL
biopax3:standardName
ETS-related transcription factor Elf-5