| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Plays a role as a potent and selective agonist of PTH2R resulting in adenyl cyclase activation and intracellular calcium levels elevation. Induces protein kinase C beta activation, recruitment of beta-arrestin and PTH2R internalization. May inhibit cell proliferation via its action on PTH2R activation. Neuropeptide which may also have a role in spermatogenesis. May activate nociceptors and nociceptive circuits. SUBUNIT: Ligand of high affinity for the PTH2 receptor (PTH2R). SUBCELLULAR LOCATION: Secreted. TISSUE SPECIFICITY: Highly expressed in fetal and adult brain, cerebellum and trachea. Weakly expressed in spinal cord, fetal liver, kidney and heart. SIMILARITY: Belongs to the parathyroid hormone family. GENE SYNONYMS:PTH2 TIP39 TIPF39. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 100 AA; 11202 MW; 7F0F1A273829E8F6 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
TIP39_HUMAN
|
| biopax3:name |
PTH2,
Parathyroid hormone 2,
TIP39
|
| biopax3:organism | |
| biopax3:sequence |
METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
|
| biopax3:standardName |
Tuberoinfundibular peptide of 39 residues
|