| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively (By similarity). FUNCTION: Factor that activates expression from a metal response element of the mouse metallothionein-I gene. SUBUNIT: Component of the RNA polymerase I (Pol I), RNA polymerase II (Pol II) and RNA polymerase III (Pol III) complexes consisting of at least 13, 12 and 17 subunits, respectively (By similarity). SUBCELLULAR LOCATION: Nucleus (By similarity). SIMILARITY: Belongs to the archaeal rpoP/eukaryotic RPC10 RNA polymerase subunit family. SEQUENCE CAUTION: Sequence=AAB27565.2; Type=Erroneous initiation; GENE SYNONYMS:Polr2k Mt1a. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 58 AA; 6974 MW; D69BB6B37416F036 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
RPAB4_MOUSE
|
| biopax3:name |
DNA-directed RNA polymerase II subunit K,
Metallothionein-I gene transcription activator,
Polr2k,
RNA polymerases I, II, and III subunit ABC4,
RPB10alpha
|
| biopax3:organism | |
| biopax3:sequence |
MDAQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
|
| biopax3:standardName |
DNA-directed RNA polymerases I, II, and III subunit RPABC4
|