| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. SUBUNIT: Interacts (via cytoplasmic C-terminal domain) with USP4; the interaction is direct (By similarity). May interact with DRD4 (By similarity). SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. DOMAIN: The cytoplasmic C-terminal domain is necessary for targeting the non-ubiquitinated form of this protein to the cell surface (By similarity). PTM: Ubiquitinated. Deubiquitinated by USP4; leading to stabilization and expression at the cell surface (By similarity). SIMILARITY: Belongs to the G-protein coupled receptor 1 family. GENE SYNONYMS:Adora2a. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 410 AA; 44971 MW; E5670F442D243E71 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
AA2AR_MOUSE
|
| biopax3:name |
Adora2a
|
| biopax3:organism | |
| biopax3:sequence |
MGSSVYIMVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGMRAKGIIAICWVLSFAIGLTPMLGWNNCSQKDENSTKTCGEGRVTCLFEDVVPMNYMVYYNFFAFVLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCSTCQHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKIIRTHVLRRQEPFRAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSAPHSGRRPNGYTLGPGGGGSTQGSPGDVELLTQEHQEGQEHPGLGDHLAQGRVGTASWSSEFAPS
|
| biopax3:standardName |
Adenosine receptor A2a
|