. "FUNCTION: Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form. SUBUNIT: Monomer (Probable). Interacts with MRC2. Interacts (via the UPAR/Ly6 domains) with SRPX2. SUBCELLULAR LOCATION: Isoform 1: Cell membrane; Lipid-anchor, GPI- anchor. SUBCELLULAR LOCATION: Isoform 2: Secreted (Probable). ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=uPAR1, GPI-anchored; IsoId=Q03405-1; Sequence=Displayed; Name=2; Synonyms=uPAR2, Secreted; IsoId=Q03405-2; Sequence=VSP_006715; Name=3; IsoId=Q03405-3; Sequence=VSP_006714; TISSUE SPECIFICITY: Expressed in neurons of the rolandic area of the brain (at protein level). Expressed in the brain. SIMILARITY: Contains 3 UPAR/Ly6 domains. WEB RESOURCE: Name=SeattleSNPs; URL=\"http://pga.gs.washington.edu/data/plaur/\"; GENE SYNONYMS:PLAUR MO3 UPAR. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . "SEQUENCE 335 AA; 36978 MW; AB1963EA3DC77171 CRC64;"^^ . . . . . . . . . . . . . . . . . . "UPAR_HUMAN"^^ . "CD87"^^ . "uPAR"^^ . "U-PAR"^^ . "Monocyte activation antigen Mo3"^^ . "PLAUR"^^ . . "MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT"^^ . "Urokinase plasminogen activator surface receptor"^^ .