| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Ubiquitin exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in lysosomal degradation; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, DNA-damage responses as well as in signaling processes leading to activation of the transcription factor NF-kappa-B. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling. FUNCTION: Ribosomal protein S27a is a component of the 40S subunit of the ribosome. SUBUNIT: Ribosomal protein S27a is part of the 40S ribosomal subunit (By similarity). SUBCELLULAR LOCATION: Ubiquitin: Cytoplasm (By similarity). Nucleus (By similarity). MISCELLANEOUS: Ubiquitin is encoded by 4 different genes. Uba52 and Rps27a genes code for a single copy of ubiquitin fused to the ribosomal proteins L40 and S27a, respectively. UBB and UBC genes code for a polyubiquitin precursor with exact head to tail repeats, the number of repeats differ between species and strains. SIMILARITY: In the N-terminal section; belongs to the ubiquitin family. SIMILARITY: In the C-terminal section; belongs to the ribosomal protein S27Ae family. SIMILARITY: Contains 1 ubiquitin-like domain. GENE SYNONYMS:Rps27a Uba80 Ubcep1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 156 AA; 17951 MW; C11DC63DF3A904F3 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
RS27A_MOUSE
|
| biopax3:name |
40S ribosomal protein S27a,
Rps27a,
Ubiquitin,
Ubiquitin carboxyl extension protein 80
|
| biopax3:entityFeature |
urn:biopax:ModificationFeature:RS27A_MOUSE_1,
urn:biopax:ModificationFeature:RS27A_MOUSE_2,
urn:biopax:ModificationFeature:RS27A_MOUSE_3,
urn:biopax:ModificationFeature:RS27A_MOUSE_4,
urn:biopax:ModificationFeature:RS27A_MOUSE_5,
urn:biopax:ModificationFeature:RS27A_MOUSE_6,
urn:biopax:ModificationFeature:RS27A_MOUSE_7
|
| biopax3:organism | |
| biopax3:sequence |
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMGSHFDRHYCGKCCLTYCFNKPEDK
|
| biopax3:standardName |
Ubiquitin-40S ribosomal protein S27a
|