. "SEQUENCE 255 AA; 29174 MW; 07817CCBD1F75B26 CRC64;"^^ . "FUNCTION: Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. SUBUNIT: Homodimer. Heterodimerizes with YWHAZ. Interacts with NDEL1, RGNEF and TIAM2 (By similarity). Interacts with HCV core protein. Interacts with ABL1 (phosphorylated form); the interaction retains it in the cytoplasm. Weakly interacts with CDKN1B. Interacts with GAB2. Interacts with phosphorylated GRB10. Interacts with PKA-phosphorylated AANAT. Interacts with the phosphorylated (by AKT1) form of SRPK2. SUBCELLULAR LOCATION: Cytoplasm (By similarity). Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P62258-1; Sequence=Displayed; Name=SV; IsoId=P62258-2; Sequence=VSP_040621; Note=Unable to dimerize with YWHAZ; SIMILARITY: Belongs to the 14-3-3 family. GENE SYNONYMS:YWHAE. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . . . . . . . . . . . . . "1433E_HUMAN"^^ . "14-3-3E"^^ . "YWHAE"^^ . . . . . . . . . "MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ"^^ . "14-3-3 protein epsilon"^^ . . . . . . . .