| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Receptor for somatostatins-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as sensitive G proteins. In RIN-5F cells, this receptor inhibits calcium entry by suppressing voltage dependent calcium-channels. SUBUNIT: The C-terminus interacts with SHANK1 PDZ domain (By similarity). SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=A; IsoId=P30680-1; Sequence=Displayed; Name=B; IsoId=P30680-2; Sequence=VSP_001924; TISSUE SPECIFICITY: Cortex, hippocampus, pituitary gland, colon adrenals, pancreas-derived cell line and pancreatic tumor. SIMILARITY: Belongs to the G-protein coupled receptor 1 family. GENE SYNONYMS:Sstr2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 369 AA; 41200 MW; 4990E489E88D7D19 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
SSR2_RAT
|
| biopax3:name |
SRIF-1,
SS-2-R,
SS2-R,
SS2R,
Sstr2
|
| biopax3:organism | |
| biopax3:sequence |
MELTSEQFNGSQVWIPSPFDLNGSLGPSNGSNQTEPYYDMTSNAVLTFIYFVVCVVGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVILTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGAEDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
|
| biopax3:standardName |
Somatostatin receptor type 2
|