| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Beta-adrenergic receptors mediate the catecholamine- induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine. SUBUNIT: Binds SLC9A3R1 and GPRASP1. Interacts with ARRB1 and ARRB2. Interacts with SRC, USP20 and USP33. Interacts with VHL; the interaction, which is increased on hydroxylation of ADRB2, ubiquitinates ADRB2 leading to its degradation. Interacts with EGLN3; the interaction hydroxylates ADRB2 facilitating VHL-E3 ligase-mediated ubiquitination (By similarity). SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein (By similarity). Note=Colocalizes with VHL on cell membranes (By similarity). PTM: Palmitoylated; may reduce accessibility of Ser-345 and Ser- 346 by anchoring Cys-341 to the plasma membrane. Agonist stimulation promotes depalmitoylation and further allows Ser-345 and Ser-346 phosphorylation (By similarity). PTM: Phosphorylated by PKA and BARK upon agonist stimulation, which mediates homologous desensitization of the receptor. PKA- mediated phosphorylation seems to facilitate phosphorylation by BARK. Phosphorylated upon DNA damage, probably by ATM or ATR (By similarity). PTM: Phosphorylation of Tyr-141 is induced by insulin and leads to supersensitization of the receptor (By similarity). PTM: Polyubiquitinated. Agonist-induced ubiquitination leads to sort internalized receptors to the lysosomes for degradation. Deubiquitination by USP20 and USP33, leads to ADRB2 recycling and resensitization after prolonged agonist stimulation. USP20 and USP33 are constitutively associated and are dissociated immediately after agonist stimulation. Ubiquitination by the VHL- E3 ligase complex is oxygen-dependent (By similarity). PTM: Hydroxylation by EGLN3 occurs only under normoxia and increases the interaction with VHL and the subsequent ubiquitination and degradation of ADRB2 (By similarity). SIMILARITY: Belongs to the G-protein coupled receptor 1 family. Adrenergic receptor subfamily. ADRB2 sub-subfamily. GENE SYNONYMS:Adrb2 Adrb2r. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 418 AA; 46891 MW; 907B2882AFC02AC5 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
ADRB2_RAT
|
| biopax3:name |
Adrb2,
Beta-2 adrenoceptor,
Beta-2 adrenoreceptor
|
| biopax3:entityFeature |
urn:biopax:ModificationFeature:ADRB2_RAT_1,
urn:biopax:ModificationFeature:ADRB2_RAT_10,
urn:biopax:ModificationFeature:ADRB2_RAT_2,
urn:biopax:ModificationFeature:ADRB2_RAT_3,
urn:biopax:ModificationFeature:ADRB2_RAT_4,
urn:biopax:ModificationFeature:ADRB2_RAT_5,
urn:biopax:ModificationFeature:ADRB2_RAT_6,
urn:biopax:ModificationFeature:ADRB2_RAT_7,
urn:biopax:ModificationFeature:ADRB2_RAT_8,
urn:biopax:ModificationFeature:ADRB2_RAT_9
|
| biopax3:organism | |
| biopax3:sequence |
MEPHGNDSDFLLAPNGSRAPGHDITQERDEAWVVGMAILMSVIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWNFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHKQAIDCYAKETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRVFQVAKRQLQKIDKSEGRFHAQNLSQVEQDGRSGHGLRSSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIRANLIPKEVYILLNWLGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSSKTYGNGYSSNSNGRTDYTGEQSAYQLGQEKENELLCEEAPGMEGFVNCQGTVPSLSIDSQGRNCNTNDSPL
|
| biopax3:standardName |
Beta-2 adrenergic receptor
|