Statements in which the resource exists as a subject.
PredicateObject
rdf:type
biopax3:comment
FUNCTION: Binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. May be involved in the process which maintains transcribable genes in an unique chromatin conformation. Inhibits the phosphorylation of nucleosomal histones H3 and H2A by RPS6KA5/MSK1 and RPS6KA3/RSK2 (By similarity). SUBCELLULAR LOCATION: Nucleus. Cytoplasm. Note=Cytoplasmic enrichment upon phosphorylation. The RNA edited version localizes to the nucleus. PTM: Phosphorylation on Ser-21 and Ser-25 weakens binding to nucleosomes and increases the rate of H3 phosphorylation (By similarity). Phosphorylation favors cytoplasmic localization. RNA EDITING: Modified_positions=Not_applicable; Note=Partially edited. A new initiator methionine may be created by a single uridine insertion in the 5'-UTR, causing an N-terminal extension of 45 amino acids. The existence of the RNA edited version is supported by direct protein sequencing by MS/MS of the following peptides specific to that version: 23-31 and 40-48. The RNA edited version is called ET-HMGN1. MASS SPECTROMETRY: Mass=10527.8; Mass_error=0.7; Method=Electrospray; Range=2-100; Source=PubMed:10739259; MASS SPECTROMETRY: Mass=10608; Method=Electrospray; Range=2-100; Source=PubMed:10739259; MASS SPECTROMETRY: Mass=10688; Mass_error=1.3; Method=Electrospray; Range=2-100; Source=PubMed:10739259; MASS SPECTROMETRY: Mass=10768; Method=Electrospray; Range=2-100; Source=PubMed:10739259; SIMILARITY: Belongs to the HMGN family. GENE SYNONYMS:HMGN1 HMG14. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License., SEQUENCE 100 AA; 10659 MW; 8F4CB5374D51FBF3 CRC64;
biopax3:xref
biopax3:displayName
HMGN1_HUMAN
biopax3:name
HMGN1, High mobility group nucleosome-binding domain-containing protein 1
biopax3:entityFeature
biopax3:organism
biopax3:sequence
MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD
biopax3:standardName
Non-histone chromosomal protein HMG-14