. "MISCELLANEOUS: The mature chain has 12 additional residues at its amino end, due to a tandem duplication of 36 nucleotides after the codon for residue 36. Residue 42 corresponds to the N-terminal residue of typical kappa chains. GENE SYNONYMS:Igk-V19-17. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . "SEQUENCE 149 AA; 16434 MW; B0480C87B682AC3E CRC64;"^^ . . . "KV5A1_MOUSE"^^ . "Igk-V19-17"^^ . "Ig kappa chain V-V region MPC11"^^ . . "MHHTSMGIKMESQIQVFVFVFLWLSGVDGDIVMTQFAGVDGDIVMTQSHKFMSTSVGDRVSITCKASQDVSTTVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSTPPTFGGGTKLEIKR"^^ . "Ig kappa chain V19-17"^^ .