. "FUNCTION: Part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box. SUBUNIT: Part of the SNAPc complex composed of 5 subunits: SNAPC1, SNAPC2, SNAPC3, SNAPC4 and SNAPC5. SNAPC5 interacts with SNAPC4. SUBCELLULAR LOCATION: Nucleus. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O75971-1; Sequence=Displayed; Name=2; IsoId=O75971-2; Sequence=VSP_012785; GENE SYNONYMS:SNAPC5 SNAP19. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . "SEQUENCE 98 AA; 11328 MW; 4D797E35AF2D1485 CRC64;"^^ . . . . . . . "SNPC5_HUMAN"^^ . "SNAPc 19 kDa subunit"^^ . "snRNA-activating protein complex 19 kDa subunit"^^ . "SNAPC5"^^ . "SNAPc subunit 5"^^ . "Small nuclear RNA-activating complex polypeptide 5"^^ . . . . "MLSRLQELRKEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSHDMLVHVDNEASINQTTLELSTKSHVTEEEEEEEEEESDS"^^ . "snRNA-activating protein complex subunit 5"^^ .