| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: May function in the process of apoptosis. TISSUE SPECIFICITY: Widely expressed. Highest levels in heart, testis, kidney, pituitary gland, adrenal gland and placenta. DEVELOPMENTAL STAGE: Expression in fetal tissues is significantly lower than in adult tissues. INDUCTION: Activated in cells undergoing apoptosis. SIMILARITY: Belongs to the PDCD5 family. GENE SYNONYMS:PDCD5 TFAR19. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 125 AA; 14285 MW; 9569E0679C3DC20D CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
PDCD5_HUMAN
|
| biopax3:name |
PDCD5,
Protein TFAR19,
TF-1 cell apoptosis-related protein 19
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY
|
| biopax3:standardName |
Programmed cell death protein 5
|