| http://identifiers.org/unip... | rdf:type | biopax3:ProteinReference | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | SEQUENCE 333 AA; 38045 MW; 15E4BCE1F4F5B3C3 CRC64; | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | FUNCTION: It may catalyze the formation of the NeuAc-alpha-2,3- Gal-beta-1,3-GalNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. It may be involved in the biosynthesis of the sialyl Lewis X determinant. Also acts on the corresponding 1,3- galactosyl derivative. CATALYTIC ACTIVITY: CMP-N-acetylneuraminate + beta-D-galactosyl- 1,4-N-acetyl-D-glucosaminyl-glycoprotein = CMP + alpha-N- acetylneuraminyl-2,3-beta-D-galactosyl-1,4-N-acetyl-D- glucosaminyl-glycoprotein. PATHWAY: Protein modification; protein glycosylation. SUBCELLULAR LOCATION: Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Secreted. Note=Membrane- bound form in trans cisternae of Golgi. Secreted into the body fluid. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=B1; IsoId=Q11206-1; Sequence=Displayed; Name=2; Synonyms=A1; IsoId=Q11206-2; Sequence=VSP_001784; Name=3; Synonyms=A2; IsoId=Q11206-3; Sequence=VSP_001785; Name=4; Synonyms=C; IsoId=Q11206-4; Sequence=VSP_001786; Name=5; IsoId=Q11206-5; Sequence=VSP_021104; TISSUE SPECIFICITY: Highly expressed in adult placenta, ovary and testes. PTM: The soluble form derives from the membrane form by proteolytic processing. SIMILARITY: Belongs to the glycosyltransferase 29 family. WEB RESOURCE: Name=GGDB; Note=GlycoGene database; URL="http://riodb.ibase.aist.go.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=ST3GAL4"; WEB RESOURCE: Name=Functional Glycomics Gateway - GTase; Note=ST3Gal IV; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_625"; GENE SYNONYMS:ST3GAL4 CGS23 NANTA3 SIAT4C STZ. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License. | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:displayName | SIA4C_HUMAN | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | 2.4.99.- | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | ST3GalA.2 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | ST3GAL4 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Alpha 2,3-sialyltransferase IV | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | STZ | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Gal-NAc6S | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | ST-4 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | SIAT4-C | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | SAT-3 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Alpha 2,3-ST 4 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Sialyltransferase 4C | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | ST3Gal IV | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | ST3GalIV | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Beta-galactoside alpha-2,3-sialyltransferase 4 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:organism | http://identifiers.org/taxo... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:sequence | MVSKSRWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:standardName | CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 | lld:biopax3 |
| http://biocyc.org/biopax/bi... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| HTTP://PATHWAYCOMMONS.ORG/P... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://www.reactome.org/bio... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
