| http://identifiers.org/unip... | rdf:type | biopax3:ProteinReference | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | SEQUENCE 419 AA; 42697 MW; 6EDC2A2082F95F23 CRC64; | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:comment | FUNCTION: Probable transcription factor which may play a role in the regulation of specific gene expression within a subset of neuronal lineages. May play a role in determining or maintaining the identities of a small subset of visual system neurons. SUBCELLULAR LOCATION: Nucleus. TISSUE SPECIFICITY: Brain. Seems to be specific to the retina. Present in the developing brain, spinal cord and eye. DEVELOPMENTAL STAGE: Expression peaks early in embryogenesis (day 13.5) and is undetectable 14 days after birth. SIMILARITY: Belongs to the POU transcription factor family. Class- 4 subfamily. SIMILARITY: Contains 1 homeobox DNA-binding domain. SIMILARITY: Contains 1 POU-specific domain. SEQUENCE CAUTION: Sequence=CAA45907.1; Type=Frameshift; Positions=11, 13, 33, 43, 57, 61, 74, 76, 133, 135, 138, 340, 342; WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL="http://atlasgeneticsoncology.org/Genes/POU4F1ID44173ch13q31.html"; GENE SYNONYMS:POU4F1 BRN3A RDC1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License. | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:UnificationXref:... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:xref | urn:biopax:RelationshipXref... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:displayName | PO4F1_HUMAN | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | POU4F1 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Brain-3A | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Oct-T1 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Brn-3A | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Homeobox/POU domain protein RDC-1 | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:name | Brain-specific homeobox/POU domain protein 3A | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:organism | http://identifiers.org/taxo... | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:sequence | MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGGGLLGGSAHPHPHMHSLGHLSHPAAAAAMNMPSGLPHPGLVAAAAHHGAAAAAAAAAAGQVAAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY | lld:biopax3 |
| http://identifiers.org/unip... | biopax3:standardName | POU domain, class 4, transcription factor 1 | lld:biopax3 |
| http://pid.nci.nih.gov/biop... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| HTTP://PATHWAYCOMMONS.ORG/P... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
| http://pid.nci.nih.gov/biop... | biopax3:entityReference | http://identifiers.org/unip... | lld:biopax3 |
