. "SEQUENCE 117 AA; 12911 MW; 39C0572EBECA2755 CRC64;"^^ . "FUNCTION: Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation. FUNCTION: Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility (By similarity). SUBCELLULAR LOCATION: Secreted. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=Ghrelin; IsoId=Q9UBU3-1; Sequence=Displayed; Name=2; Synonyms=des-Gln14-ghrelin; IsoId=Q9UBU3-2; Sequence=VSP_003245; Name=3; IsoId=Q9UBU3-3; Sequence=VSP_041437; Name=4; IsoId=Q9UBU3-4; Sequence=VSP_041437, VSP_003245; Name=5; IsoId=Q9UBU3-5; Sequence=VSP_041438; TISSUE SPECIFICITY: Highest level in stomach. All forms are found in serum as well. Other tissues compensate for the loss of ghrelin synthesis in the stomach following gastrectomy. PTM: O-octanoylation or O-decanoylation is essential for ghrelin activity. The O-decanoylated forms Ghrelin-27-C10 and Ghrelin-28- C10 differ in the length of the carbon backbone of the carboxylic acid bound to Ser-26. A small fraction of ghrelin, ghrelin-28- C10:1, may be modified with a singly unsaturated carboxylic acid. PTM: Amidation of Leu-98 is essential for obestatin activity (By similarity). MASS SPECTROMETRY: Mass=3398.9; Mass_error=0.3; Method=Electrospray; Range=24-51; Note=Ghrelin-28-C10, O- decanoylated form; Source=PubMed:12414809; MASS SPECTROMETRY: Mass=3397.2; Mass_error=0.5; Method=Electrospray; Range=24-51; Note=Ghrelin-28-C10:1, O- decenoylated form; Source=PubMed:12414809; MASS SPECTROMETRY: Mass=3371.3; Mass_error=0.1; Method=Electrospray; Range=24-51; Note=Ghrelin-28-C8, O- octanoylated form; Source=PubMed:12414809; MASS SPECTROMETRY: Mass=3243.6; Mass_error=0.4; Method=Electrospray; Range=24-50; Note=Ghrelin-27-C10, O- decanoylated form; Source=PubMed:12414809; MASS SPECTROMETRY: Mass=3214.6; Mass_error=0.6; Method=Electrospray; Range=24-50; Note=Ghrelin-27-C8, O- octanoylated form; Source=PubMed:12414809; SIMILARITY: Belongs to the motilin family. WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL=\"http://atlasgeneticsoncology.org/Genes/GhrelinID327.html\"; WEB RESOURCE: Name=Protein Spotlight; Note=Gut feelings - Issue 66 of January 2006; URL=\"http://web.expasy.org/spotlight/back_issues/sptlt066.shtml\"; WEB RESOURCE: Name=Wikipedia; Note=Ghrelin entry; URL=\"http://en.wikipedia.org/wiki/Ghrelin\"; GENE SYNONYMS:GHRL MTLRP. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . . . . . . . . . . . . . . . . "GHRL_HUMAN"^^ . "GHRL"^^ . "Growth hormone-releasing peptide"^^ . "Motilin-related peptide"^^ . "Growth hormone secretagogue"^^ . "Ghrelin"^^ . "Ghrelin-28"^^ . "Protein M46"^^ . "Ghrelin-27"^^ . "Obestatin"^^ . . . "MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK"^^ . "Appetite-regulating hormone"^^ .