. "FUNCTION: Transcriptional repressor, which probably repress transcription by binding directly the 5'-CTGTCAA-3' DNA sequence or by interacting with TGF-beta activated SMAD proteins. Probably represses transcription via the recruitment of histone deacetylase proteins. SUBUNIT: Interacts with the transcriptional modulator SMAD3 and the histone deacetylase HDAC1. SUBCELLULAR LOCATION: Nucleus. Note=Excluded from nucleoli. TISSUE SPECIFICITY: Widely expressed. Highly expressed in heart, kidney and testis. Weakly expressed in brain and prostate. PTM: The C-terminal part is phosphorylated in response to EGF signaling by the Ras/MAPK pathway. MISCELLANEOUS: TGIF2 is amplified and overexpressed in several ovarian cancer cell lines. SIMILARITY: Belongs to the TALE/TGIF homeobox family. SIMILARITY: Contains 1 homeobox DNA-binding domain. GENE SYNONYMS:TGIF2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . "SEQUENCE 237 AA; 25878 MW; E78101CF7EF12555 CRC64;"^^ . . . . . . . . . . "TGIF2_HUMAN"^^ . "TGIF2"^^ . "TGF-beta-induced transcription factor 2"^^ . "TGFB-induced factor 2"^^ . "5'-TG-3'-interacting factor 2"^^ . . . . "MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ"^^ . "Homeobox protein TGIF2"^^ .