. "SEQUENCE 103 AA; 11967 MW; 72B9BD179A6808D0 CRC64;"^^ . "FUNCTION: May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC. SUBUNIT: Binds via its C-terminal region to the N-terminal region of MYC. Associates with AKAP1/S-AKAP84. Interacts with MYCBPAP. SUBCELLULAR LOCATION: Cytoplasm. Nucleus. Mitochondrion. Note=Translocates into the nucleus in the S phase of the cell cycle upon an increase of MYC expression. Found in the mitochondria when associated with AKAP1. TISSUE SPECIFICITY: Highly expressed in heart, placenta, pancreas, skeletal muscle and kidney. Also present at low levels in lung. SIMILARITY: Belongs to the AMY1 family. GENE SYNONYMS:MYCBP AMY1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . . . . . . . . "MYCBP_HUMAN"^^ . "AMY-1"^^ . "Associate of Myc 1"^^ . "MYCBP"^^ . . "MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE"^^ . "C-Myc-binding protein"^^ .