. "FUNCTION: May play a role in apoptosis. Isoform 1 seems to be the main initiator. SUBUNIT: Interacts with MCL1, BCL2, BCL2L1/BCL-Xl, BCL2A1 and BCL2L2/BCL-w. Interacts with the myosin V actin motor complex through its binding to DLC2 (By similarity). ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=BMF-I; IsoId=Q96LC9-1; Sequence=Displayed; Name=2; Synonyms=BMF-II; IsoId=Q96LC9-2; Sequence=VSP_012292; Name=3; Synonyms=BMF-III; IsoId=Q96LC9-3; Sequence=VSP_012293, VSP_012294; TISSUE SPECIFICITY: Isoform 1 is mainly expressed in B-lymphoid cells. Isoform 2 and isoform 3 are mainly expressed in B-CLL and normal B-cells. SIMILARITY: Belongs to the Bcl-2 family. SEQUENCE CAUTION: Sequence=AAH60783.1; Type=Erroneous initiation; Sequence=BAB15762.1; Type=Erroneous initiation; GENE SYNONYMS:BMF. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . "SEQUENCE 184 AA; 20508 MW; 21479B25CC727853 CRC64;"^^ . . . . . . . . . . . . . . . "BMF_HUMAN"^^ . "BMF"^^ . . "MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR"^^ . "Bcl-2-modifying factor"^^ .