. "FUNCTION: May be involved in the generation of reactive oxygen species (ROS). Has low NADPH-dependent beta-naphthoquinone reductase activity, with a preference for 1,2-beta-naphthoquinone over 1,4-beta-naphthoquinone. Has low NADPH-dependent diamine reductase activity (in vitro). BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=215 uM for 1,2-naphthoquinone; SUBUNIT: Homodimer. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Comment=UV radiation favors the production of isoform 2; Name=1; IsoId=Q53FA7-1; Sequence=Displayed; Note=Major isoform under normal light conditions; Name=2; Synonyms=PIG3AS; IsoId=Q53FA7-2; Sequence=VSP_015783, VSP_015784; Note=Major isoform under UV light exposure. Undergoes rapid proteolytic degradation by the proteasome; INDUCTION: Isoform 1 and isoform 2 are both activated by p53/TP53, doxorubicin, etoposide and ionizing radiation. Isoform 2 is highly activated by UV radiation. SIMILARITY: Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily. SEQUENCE CAUTION: Sequence=AAC39535.1; Type=Erroneous gene model prediction; WEB RESOURCE: Name=NIEHS-SNPs; URL=\"http://egp.gs.washington.edu/data/tp53i3/\"; GENE SYNONYMS:TP53I3 PIG3. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . "SEQUENCE 332 AA; 35536 MW; C5A33C46B3F96473 CRC64;"^^ . . . . . . . . . . . . . "QORX_HUMAN"^^ . "1.-.-.-"^^ . "p53-induced gene 3 protein"^^ . "Tumor protein p53-inducible protein 3"^^ . "TP53I3"^^ . . . . "MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ"^^ . "Quinone oxidoreductase PIG3"^^ .