. "SEQUENCE 100 AA; 11309 MW; 347E9163157AFF42 CRC64;"^^ . "FUNCTION: SNARE involved in vesicular transport from the late endosomes to the trans-Golgi network. SUBUNIT: Interacts with BVES (via the C-terminus cytoplasmic tail) (By similarity). SUBCELLULAR LOCATION: Membrane; Single-pass type IV membrane protein (Probable). Cell junction, synapse, synaptosome (By similarity). PTM: Phosphorylated upon DNA damage, probably by ATM or ATR. SIMILARITY: Belongs to the synaptobrevin family. SIMILARITY: Contains 1 v-SNARE coiled-coil homology domain. GENE SYNONYMS:VAMP3 SYB3. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . . . . . "VAMP3_HUMAN"^^ . "Synaptobrevin-3"^^ . "VAMP-3"^^ . "Cellubrevin"^^ . "CEB"^^ . "VAMP3"^^ . . . . "MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS"^^ . "Vesicle-associated membrane protein 3"^^ .