. "FUNCTION: Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. Anchors XPB. SUBUNIT: One of the 6 subunits forming the core-TFIIH basal transcription factor which associates with the CAK complex composed of CDK7, CCNH/cyclin H and MNAT1 to form the TFIIH basal transcription factor. Interacts with RARA; the interaction requires prior phosphorylation of RARA on 'Ser-369' which then enhances interaction of RARA with CDK7 (By similarity). SUBCELLULAR LOCATION: Nucleus. SIMILARITY: Belongs to the TFB4 family. SEQUENCE CAUTION: Sequence=CAA82909.1; Type=Frameshift; Positions=302; WEB RESOURCE: Name=NIEHS-SNPs; URL=\"http://egp.gs.washington.edu/data/gtf2h3/\"; GENE SYNONYMS:GTF2H3. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . "SEQUENCE 308 AA; 34378 MW; E739E2176CD6BAA5 CRC64;"^^ . . . . . . . . "TF2H3_HUMAN"^^ . "BTF2 p34"^^ . "General transcription factor IIH polypeptide 3"^^ . "TFIIH basal transcription factor complex p34 subunit"^^ . "Basic transcription factor 2 34 kDa subunit"^^ . "GTF2H3"^^ . . "MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKLKVSA"^^ . "General transcription factor IIH subunit 3"^^ .