. "SEQUENCE 176 AA; 20295 MW; 8FC8DB4BB094CE6A CRC64;"^^ . "FUNCTION: Nociceptin is the ligand of the opioid receptor-like receptor (OPRL1). It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. May be involved in neuronal differentiation and development (By similarity). SUBCELLULAR LOCATION: Secreted. TISSUE SPECIFICITY: Predominantly expressed in the brain and spinal cord. PTM: Specific enzymatic cleavages at paired basic residues probably yield other active peptides besides nociceptin. PTM: The N-terminal domain contains 6 conserved cysteines thought to be involved in disulfide bonding and/or processing. SIMILARITY: Belongs to the opioid neuropeptide precursor family. GENE SYNONYMS:PNOC OFQ. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . . . . . "PNOC_HUMAN"^^ . "Nociceptin"^^ . "Neuropeptide 2"^^ . "Neuropeptide 1"^^ . "Orphanin FQ"^^ . "PPNOC"^^ . "PNOC"^^ . . "MKVLLCDLLLLSLFSSVFSSCQRDCLTCQEKLHPALDSFDLEVCILECEEKVFPSPLWTPCTKVMARSSWQLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV"^^ . "Prepronociceptin"^^ .