. "FUNCTION: Substrate recognition component of a SCF (SKP1-CUL1-F- box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Specifically recognizes phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. Degradation of CDKN1B/p27kip also requires CKS1. Recognizes target proteins ORC1, CDT1, RBL2, MLL, CDK9, RAG2, FOXO1A, UBP43, and probably MYC, TOB1 and TAL1. Degradation of TAL1 also requires STUB1. Recognizes CDKN1A in association with CCNE1 or CCNE2 and CDK2. PATHWAY: Protein modification; protein ubiquitination. SUBUNIT: Part of a SCF(SKP2) complex consisting of CUL1, RBX1, SKP1 and SKP2. Component of a SCF(SKP2)-like complex containing CUL1, SKP1, TRIM21 and SKP2. Interacts directly with CUL1 and SKP1. Interacts with CKS1. Interacts with the cyclin-A-CDK2 complex. Interacts with ORC1, phosphorylated CDT1, phosphorylated RBL2, ELF4, phosphorylated RAG2, FOXO1A, UBP43, MYC, TOB1, TAL1 and MLL. Interacts with TRIM21. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=SKP2-alpha; IsoId=Q13309-1; Sequence=Displayed; Name=2; Synonyms=SKP2-beta; IsoId=Q13309-2; Sequence=VSP_008432; PTM: Ubiquitinated by the APC/C complex, leading to its degradation by the proteasome. Deubiquitinated by USP13. SIMILARITY: Contains 1 F-box domain. SIMILARITY: Contains 10 LRR (leucine-rich) repeats. SEQUENCE CAUTION: Sequence=AAC50242.1; Type=Erroneous initiation; Note=Translation N-terminally shortened; Sequence=BAB87202.1; Type=Miscellaneous discrepancy; Note=Probable cloning artifact; GENE SYNONYMS:SKP2 FBXL1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . "SEQUENCE 424 AA; 47761 MW; F29B7C338A7A37E9 CRC64;"^^ . . . . . . . . . . "SKP2_HUMAN"^^ . "SKP2"^^ . "Cyclin-A/CDK2-associated protein p45"^^ . "p45skp2"^^ . "F-box protein Skp2"^^ . "F-box/LRR-repeat protein 1"^^ . . . . "MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL"^^ . "S-phase kinase-associated protein 2"^^ .