. "FUNCTION: Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. PATHWAY: Protein modification; protein ubiquitination. SUBUNIT: The APC/C is composed of at least 12 subunits. Interacts with PPP5C and CDC20. SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton, centrosome. Cytoplasm, cytoskeleton, spindle. Note=Colocalizes with CDC27 to the centrosome at all stages of the cell cycle and to the mitotic spindle. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q13042-1; Sequence=Displayed; Name=2; IsoId=Q13042-2; Sequence=VSP_008427; Note=No experimental confirmation available; Name=3; IsoId=Q13042-3; Sequence=VSP_008427, VSP_008428; PTM: Phosphorylated. Phosphorylation on Ser-560 occurs specifically during mitosis. SIMILARITY: Belongs to the APC6/CDC16 family. SIMILARITY: Contains 7 TPR repeats. WEB RESOURCE: Name=NIEHS-SNPs; URL=\"http://egp.gs.washington.edu/data/cdc16/\"; GENE SYNONYMS:CDC16 ANAPC6. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . "SEQUENCE 620 AA; 71656 MW; A9C4F24615DF17EB CRC64;"^^ . . . . . . . . . . "CDC16_HUMAN"^^ . "Cyclosome subunit 6"^^ . "Anaphase-promoting complex subunit 6"^^ . "APC6"^^ . "CDC16Hs"^^ . "CDC16 homolog"^^ . "CDC16"^^ . . . . . . . . "MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETFEIEMNESDMMLETSMSDHST"^^ . "Cell division cycle protein 16 homolog"^^ .