. "SEQUENCE 142 AA; 15536 MW; 962BD69CCB30D51F CRC64;"^^ . "FUNCTION: This enzyme scavenge exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis. CATALYTIC ACTIVITY: Cytidine + H(2)O = uridine + NH(3). COFACTOR: Zinc. SUBUNIT: Homodimer. MISCELLANEOUS: Present with 3120 molecules/cell in log phase SD medium. SIMILARITY: Belongs to the cytidine and deoxycytidylate deaminase family. GENE SYNONYMS:CDD1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . . . . . "CDD_YEAST"^^ . "Cytidine aminohydrolase"^^ . "3.5.4.5"^^ . "CDA"^^ . "CDD1"^^ . . "MKVGGIEDRQLEALKRAALKACELSYSPYSHFRVGCSILTNNDVIFTGANVENASYSNCICAERSAMIQVLMAGHRSGWKCMVICGDSEDQCVSPCGVCRQFINEFVVKDFPIVMLNSTGSRSKVMTMGELLPMAFGPSHLN"^^ . "Cytidine deaminase"^^ .