. "SEQUENCE 116 AA; 12691 MW; 4A0D0D56B5409D0A CRC64;"^^ . "FUNCTION: Involved in the targeting and/or fusion of transport vesicles to their target membrane (By similarity). SUBUNIT: Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. This complex binds to CPLX1. Interacts with BVES and STX4. Interacts with VAPA and VAPB (By similarity). SUBCELLULAR LOCATION: Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type IV membrane protein. Cell junction, synapse, synaptosome. Note=Neuronal synaptic vesicles. TISSUE SPECIFICITY: Nervous system specific. A higher level expression is seen in the brain as compared to the spinal cord. SIMILARITY: Belongs to the synaptobrevin family. SIMILARITY: Contains 1 v-SNARE coiled-coil homology domain. GENE SYNONYMS:Vamp2 Syb2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . . . . . "VAMP2_RAT"^^ . "Synaptobrevin-2"^^ . "Vamp2"^^ . "VAMP-2"^^ . . . . "MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST"^^ . "Vesicle-associated membrane protein 2"^^ .