. "FUNCTION: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N- hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk. CATALYTIC ACTIVITY: 3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate. SUBUNIT: Homodimer. SUBCELLULAR LOCATION: Cytoplasm. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P50225-1; Sequence=Displayed; Name=2; IsoId=P50225-2; Sequence=VSP_040101; Note=No experimental confirmation available; TISSUE SPECIFICITY: Liver, lung, adrenal, brain, platelets and skin. SIMILARITY: Belongs to the sulfotransferase 1 family. GENE SYNONYMS:SULT1A1 STP STP1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . "SEQUENCE 295 AA; 34165 MW; 7D4362A603A29176 CRC64;"^^ . . . . . . . . . . . . . . "ST1A1_HUMAN"^^ . "2.8.2.1"^^ . "SULT1A1"^^ . "Ts-PST"^^ . "P-PST 1"^^ . "HAST1/HAST2"^^ . "Aryl sulfotransferase 1"^^ . "Thermostable phenol sulfotransferase"^^ . "ST1A1"^^ . "ST1A3"^^ . "Phenol-sulfating phenol sulfotransferase 1"^^ . "Phenol sulfotransferase 1"^^ . . "MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL"^^ . "Sulfotransferase 1A1"^^ .