. "FUNCTION: May play a role in growth regulation. Is associated with G2/M phase arrest in response to DNA damage. May be an intermediate by which p53 mediates its role as an inhibitor of cellular proliferation. SUBCELLULAR LOCATION: Nucleus (By similarity). DEVELOPMENTAL STAGE: Induced within 3 hours after growth stimulation, remains elevated with no apparent cell cycle dependency. INDUCTION: By doxorubicin (DOX). SIMILARITY: Belongs to the cyclin family. Cyclin G subfamily. GENE SYNONYMS:Ccng1 Ccng. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . "SEQUENCE 294 AA; 33934 MW; 229A5588E66F0DBC CRC64;"^^ . . . . . "CCNG1_RAT"^^ . "Cyclin-G"^^ . "Ccng1"^^ . . "MIEVLTTDSQKLLHQLNTLLEQESRCQPKVCGLKLIESAHDNGLRMTARLRDFEVKDLLSLTQFFGFDTETFSLAVNLLDRFLSKMKVQAKHLGCVGLSCFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEKIVLEKVCWKVKATTAFQFLQLYYSLIRETLPFERRNDLNFERLEAQLKACHCRIIFSKAKPSVLALAIIALEIQALKYVELTEGVECIQKHSKISGRDLTFWQELVSKCLTEYSSNKCSKPNGQKLKWIVSGRTARQLKHSYYRITHLPTIPETMG"^^ . "Cyclin-G1"^^ .