. "SEQUENCE 458 AA; 51821 MW; 9E76B3FFD3E09C93 CRC64;"^^ . "FUNCTION: This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. SUBUNIT: Interacts with MPDZ. Interacts with ARRB2. SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. DOMAIN: The PDZ domain-binding motif is involved in the interaction with MPDZ. PTM: N-glycosylated. RNA EDITING: Modified_positions=156, 158, 160; Note=Partially edited. RNA editing generates receptor isoforms that differ in their ability to interact with the phospholipase C signaling cascade in a transfected cell line, suggesting that this RNA processing event may contribute to the modulation of serotonergic neurotransmission in the central nervous system. POLYMORPHISM: Position 23 is polymorphic; the frequencies in unrelated Caucasians are 0.87 for Cys and 0.13 for Ser. SIMILARITY: Belongs to the G-protein coupled receptor 1 family. GENE SYNONYMS:HTR2C HTR1C. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . . . . . . . . . "5HT2C_HUMAN"^^ . "HTR2C"^^ . "5-HT1C"^^ . "5-HT2C"^^ . "5-hydroxytryptamine receptor 1C"^^ . "5-HT-2C"^^ . "Serotonin receptor 2C"^^ . "5-HT-1C"^^ . "5-HTR2C"^^ . . "MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV"^^ . "5-hydroxytryptamine receptor 2C"^^ .