. "FUNCTION: Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol- calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3. SUBUNIT: Interacts with HDAC7 and KAT5. SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=P25101-1; Sequence=Displayed; Name=2; Synonyms=Delta-3; IsoId=P25101-2; Sequence=VSP_011059, VSP_011060; Name=3; Synonyms=Delta-4; IsoId=P25101-3; Sequence=VSP_011062, VSP_011063; Name=4; Synonyms=Delta-3,4; IsoId=P25101-4; Sequence=VSP_011061; TISSUE SPECIFICITY: Isoform 1, isoform 3 and isoform 4 are expressed in a variety of tissues, with highest levels in the aorta and cerebellum, followed by lung, atrium and cerebral cortex, lower levels in the placenta, kidney, adrenal gland, duodenum, colon, ventricle and liver but no expression in umbilical vein endothelial cells. Within the placenta, isoform 1, isoform 2, isoform 3 and isoform 4 are expressed in the villi and stem villi vessels. SIMILARITY: Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRA sub-subfamily. WEB RESOURCE: Name=NIEHS-SNPs; URL=\"http://egp.gs.washington.edu/data/ednra/\"; GENE SYNONYMS:EDNRA ETA ETRA. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . "SEQUENCE 427 AA; 48722 MW; 207272D4A231404F CRC64;"^^ . . . . . . . . . . . . "EDNRA_HUMAN"^^ . "EDNRA"^^ . "Endothelin A receptor"^^ . "ET-A"^^ . "hET-AR"^^ . "ETA-R"^^ . . "METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN"^^ . "Endothelin-1 receptor"^^ .