. "SEQUENCE 351 AA; 40623 MW; 5C7443FBBA1C9BEC CRC64;"^^ . "FUNCTION: Mediates cAMP-dependent signaling triggered by receptor binding to GPCRs. PKA activation regulates diverse cellular processes such as cell proliferation, the cell cycle, differentiation and regulation of microtubule dynamics, chromatin condensation and decondensation, nuclear envelope disassembly and reassembly, as well as regulation of intracellular transport mechanisms and ion flux. Regulates the abundance of compartmentalized pools of its regulatory subunits through phosphorylation of PJA2 which binds and ubiquitinates these subunits, leading to their subsequent proteolysis. CATALYTIC ACTIVITY: ATP + a protein = ADP + a phosphoprotein. COFACTOR: Magnesium. ENZYME REGULATION: Activated by cAMP. SUBUNIT: A number of inactive tetrameric holoenzymes are produced by the combination of homo- or heterodimers of the different regulatory subunits associated with two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. The cAMP-dependent protein kinase catalytic subunit binds PJA2 (By similarity). SUBCELLULAR LOCATION: Cytoplasm. Cell membrane. Nucleus (By similarity). Note=Translocates into the nucleus (monomeric catalytic subunit) (By similarity). The inactive holoenzyme is found in the cytoplasm (By similarity). ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=9; Name=1; Synonyms=Beta1; IsoId=P22694-1; Sequence=Displayed; Name=2; Synonyms=Beta2; IsoId=P22694-2; Sequence=VSP_017364; Name=3; Synonyms=Beta3; IsoId=P22694-3; Sequence=VSP_017369, VSP_017370; Note=Incomplete sequence; Name=4; Synonyms=Beta4; IsoId=P22694-4; Sequence=VSP_017368, VSP_017371; Note=Incomplete sequence; Name=5; Synonyms=Beta4ab; IsoId=P22694-5; Sequence=VSP_017366; Note=Incomplete sequence; Name=6; Synonyms=Beta4abc; IsoId=P22694-6; Sequence=VSP_017365; Name=7; IsoId=P22694-7; Sequence=VSP_017367; Note=No experimental confirmation available; Name=8; IsoId=P22694-8; Sequence=VSP_036556, VSP_036557; Name=9; IsoId=P22694-9; Sequence=VSP_043372; Note=No experimental confirmation available; TISSUE SPECIFICITY: Isoform 1 is most abundant in the brain, with low level expression in kidney. Isoform 2 is predominantly expressed in thymus, spleen and kidney. Isoform 3 and isoform 4 are only expressed in the brain. PTM: Asn-3 is partially deaminated to Asp giving rise to 2 major isoelectric variants, called CB and CA respectively (By similarity). SIMILARITY: Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily. SIMILARITY: Contains 1 AGC-kinase C-terminal domain. SIMILARITY: Contains 1 protein kinase domain. SEQUENCE CAUTION: Sequence=BAD92426.1; Type=Frameshift; Positions=322; WEB RESOURCE: Name=SeattleSNPs; URL=\"http://pga.gs.washington.edu/data/prkacb/\"; GENE SYNONYMS:PRKACB. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . . . . . . . . . . . . . . . . . . . . . . . . . . . . "KAPCB_HUMAN"^^ . "PKA C-beta"^^ . "PRKACB"^^ . "2.7.11.11"^^ . . . . . . . "MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF"^^ . "cAMP-dependent protein kinase catalytic subunit beta"^^ .