. "SEQUENCE 192 AA; 21429 MW; 2A1F1266B07C3210 CRC64;"^^ . "FUNCTION: Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as secretory processes, phagocytose of apoptotic cells and epithelial cell polarization. Augments the production of reactive oxygen species (ROS) by NADPH oxidase. ENZYME REGULATION: Regulated by guanine nucleotide exchange factors (GEFs) which promote the exchange of bound GDP for free GTP, GTPase activating proteins (GAPs) which increase the GTP hydrolysis activity, and GDP dissociation inhibitors which inhibit the dissociation of the nucleotide from the GTPase. SUBUNIT: Interacts with DOCK2, which may activate it. SUBCELLULAR LOCATION: Cytoplasm. Note=Membrane-associated when activated. TISSUE SPECIFICITY: Hematopoietic specific. DISEASE: Defects in RAC2 are the cause of neutrophil immunodeficiency syndrome (NEUID) [MIM:608203]. SIMILARITY: Belongs to the small GTPase superfamily. Rho family. WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL=\"http://atlasgeneticsoncology.org/Genes/RAC2ID42021ch22q13.html\"; WEB RESOURCE: Name=RAC2base; Note=RAC2 mutation db; URL=\"http://bioinf.uta.fi/RAC2base/\"; GENE SYNONYMS:RAC2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . . . . . . "RAC2_HUMAN"^^ . "RAC2"^^ . "p21-Rac2"^^ . "Small G protein"^^ . "GX"^^ . . . . . "MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL"^^ . "Ras-related C3 botulinum toxin substrate 2"^^ .