. "FUNCTION: Binds specifically to the 3'-terminal U-tract of U6 snRNA. SUBUNIT: LSm subunits form a heteromer with a doughnut shape. SUBCELLULAR LOCATION: Nucleus (Potential). SIMILARITY: Belongs to the snRNP Sm proteins family. GENE SYNONYMS:NAA38 LSM8. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . "SEQUENCE 96 AA; 10403 MW; 15D26E6B75AA2EE1 CRC64;"^^ . . . . . "NAA38_HUMAN"^^ . "NAA38"^^ . "U6 snRNA-associated Sm-like protein LSm8"^^ . . . "MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH"^^ . "N-alpha-acetyltransferase 38, NatC auxiliary subunit"^^ .